Research

Peptide research

Beneath every plain-English guide on Chemdu is real chemistry — how peptides are built, identified, measured and modelled. This is the research side: the methods scientists use, and our own IR + AI spectroscopy platform.

How peptides are studied

A peptide’s behaviour comes entirely from its sequence and shape, so research is about pinning those down precisely — identity, purity, structure and how it folds and interacts. The main tools:

Vibrational (IR) spectroscopyEvery bond vibrates at a characteristic frequency, giving a molecular “fingerprint” used to identify groups and read protein secondary structure (amide bands).Our platform ↓

Mass spectrometryWeighs the molecule and its fragments to determine mass and, with fragmentation, the amino-acid sequence — the gold standard for primary sequence.

NMR & crystallographyResolve 3-D structure and dynamics atom by atom — how a peptide actually folds and moves in solution or a crystal.

Computational chemistryQuantum and force-field methods predict spectra, geometries and energies — and increasingly feed machine-learning models.

Chemdu’s research focus is the first and last of these — infrared spectroscopy paired with AI — to identify compounds, functional groups and secondary structure from their vibrational fingerprints.

Peptide tracker

Every peptide worth knowing — mainstream medicines, investigational candidates, grey-market “research” compounds, cosmetics and supplements — with its status at a glance. Search or filter by status.

Peptide	Also known as	Use	Status

Peptide research profiles

A closer look at well-studied peptides — the exact amino-acid sequence, the receptor or enzyme it acts on, the signalling pathway it triggers, and the solved 3-D structure (PDB) that shows how it binds. Each links to current literature.

GLP-1 (7–36 amide)

Incretin hormone · receptor agonist

Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Binds: GLP-1 receptor (GLP-1R) — class B GPCR
Pathway: Gα_s → adenylate cyclase → cAMP → PKA → glucose-dependent insulin secretion
Structure: PDB 5VAI — GLP-1·GLP-1R·G_s

Current research ↗ Semaglutide guide →

Insulin

Metabolic hormone · binds an enzyme

Sequence: A: GIVEQCCTSICSLYQLENYCN
B: FVNQHLCGSHLVEALYLVCGERGFFYTPKT (3 disulfides)
Binds: Insulin receptor (INSR) — a receptor tyrosine kinase (enzyme)
Pathway: Receptor autophosphorylation → IRS-1 → PI3K → Akt → GLUT4 glucose uptake
Structure: PDB 4INS — 2-Zn insulin

Current research ↗ Therapeutic peptides →

Oxytocin

Neuropeptide · receptor agonist

Sequence: CYIQNCPLG-NH₂ (disulfide Cys1–Cys6)
Binds: Oxytocin receptor (OXTR) — class A GPCR
Pathway: Gα_q → PLCβ → IP₃ / DAG → intracellular Ca²⁺ release
Structure: PDB 7RYC — OXTR·oxytocin·G_q

Current research ↗

Angiotensin II

Vasoactive hormone · receptor agonist

Sequence: DRVYIHPF
Binds: AT₁ receptor (AGTR1) — class A GPCR
Pathway: Gα_q → PLC → IP₃/Ca²⁺ → vasoconstriction (& β-arrestin)
Structure: PDB 7F6G — AT₁R·Sar1-AngII·G_q

Current research ↗

Lactotripeptides (IPP / VPP)

Dietary bioactive · enzyme inhibitor

Sequence: IPP (Ile-Pro-Pro) & VPP (Val-Pro-Pro)
Inhibits: Angiotensin-converting enzyme (ACE) — a zinc metallopeptidase (enzyme)
Pathway: Block ACE → less angiotensin I→II → renin–angiotensin system down → lower blood pressure
Structure: PDB 1O86 — human ACE

Current research ↗ Dietary peptides →

Sequences use standard one-letter amino-acid codes; PDB codes link to the RCSB Protein Data Bank. “Current research” opens a live PubMed search sorted by date.

The platform

IR + AI spectroscopy research platform

Our research-grade platform for doctoral researchers and professors: a large database of measured infrared spectra, quantum-chemical simulation, and machine-learning models that read functional groups and secondary structure from IR — especially the diagnostic fingerprint region.

OverviewThe IR + AI program, objectives and honest scope IR spectra database1,000+ measured gas-phase spectra, searchable + overlay viewer Band reference atlasFunctional-group frequencies with mode assignments AI fingerprintingML models: functional-group ID & compound retrieval Simulate IRIn-browser IR spectrum simulator IR → structureReading secondary structure & residues from IR

Enter the research platform →

Why this matters for the peptides you read about

The same science underpins the consumer questions our guides answer:

Identity & purity — spectroscopy and mass spec are how a lab knows a vial actually contains what the label claims (a core problem with grey-market research peptides).
Structure → function — how a peptide folds decides what it does; IR’s amide bands report on that folding.
Sequence — the exact order of amino acids is a peptide’s identity, tuned by drug makers one residue at a time (see semaglutide and tirzepatide).

All peptides A–Z → Peptide calculator → IR + AI platform →

Chemdu’s research platform is an educational and scientific resource. The consumer guides elsewhere on the site are general information and not medical advice.